was read the article
array:22 [ "pii" => "S1576988721000777" "issn" => "15769887" "doi" => "10.1016/j.vacun.2021.10.002" "estado" => "S300" "fechaPublicacion" => "2022-05-01" "aid" => "213" "copyright" => "Elsevier España, S.L.U.. All rights reserved" "copyrightAnyo" => "2021" "documento" => "article" "crossmark" => 1 "subdocumento" => "fla" "cita" => "Vacunas. 2022;23 Supl 1:S1-S13" "abierto" => array:3 [ "ES" => false "ES2" => false "LATM" => false ] "gratuito" => false "lecturas" => array:1 [ "total" => 0 ] "itemSiguiente" => array:19 [ "pii" => "S1576988722000279" "issn" => "15769887" "doi" => "10.1016/j.vacun.2022.01.008" "estado" => "S300" "fechaPublicacion" => "2022-05-01" "aid" => "230" "copyright" => "Elsevier España, S.L.U." "documento" => "article" "crossmark" => 1 "subdocumento" => "fla" "cita" => "Vacunas. 2022;23 Supl 1:S14-S21" "abierto" => array:3 [ "ES" => false "ES2" => false "LATM" => false ] "gratuito" => false "lecturas" => array:1 [ "total" => 0 ] "es" => array:13 [ "idiomaDefecto" => true "cabecera" => "<span class="elsevierStyleTextfn">Original</span>" "titulo" => "Evaluación de la respuesta de los anticuerpos IGG específicos contra SARS-CoV-2 en el personal de salud con el esquema completo de la vacuna Sputnik V (Gam-COVID-Vac)" "tienePdf" => "es" "tieneTextoCompleto" => "es" "tieneResumen" => array:2 [ 0 => "es" 1 => "en" ] "paginas" => array:1 [ 0 => array:2 [ "paginaInicial" => "S14" "paginaFinal" => "S21" ] ] "titulosAlternativos" => array:1 [ "en" => array:1 [ "titulo" => "Assessment of the humoral immunity induced by Sputnik V COVID-19 vaccine (Gam-COVID-Vac) in healthcare workers" ] ] "contieneResumen" => array:2 [ "es" => true "en" => true ] "contieneTextoCompleto" => array:1 [ "es" => true ] "contienePdf" => array:1 [ "es" => true ] "resumenGrafico" => array:2 [ "original" => 0 "multimedia" => array:8 [ "identificador" => "f0015" "etiqueta" => "Figura 3" "tipo" => "MULTIMEDIAFIGURA" "mostrarFloat" => true "mostrarDisplay" => false "figura" => array:1 [ 0 => array:4 [ "imagen" => "gr3.jpeg" "Alto" => 945 "Ancho" => 695 "Tamanyo" => 107727 ] ] "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0015" "detalle" => "Figura " "rol" => "short" ] ] "descripcion" => array:1 [ "es" => "<p id="sp0020" class="elsevierStyleSimplePara elsevierViewall">Nivel de anticuerpos anti-SARS-CoV-2 detectados en 630 trabajadores de la salud vacunados con 2 dosis de Sputnik V de acuerdo con el tiempo transcurrido hasta la realización de la serología.</p> <p id="sp0025" class="elsevierStyleSimplePara elsevierViewall">Ref. S/Co: relación entre la señal obtenida (absorbancia) y el punto de corte. La línea roja corresponde a la mediana. Las líneas negras punteadas corresponden al rango intercuartílico.</p>" ] ] ] "autores" => array:1 [ 0 => array:2 [ "autoresLista" => "Ezequiel Cordova, M. Ines Lespada, Diego Cecchini, Fabiola Nieto, Susana Palonski, Mariana Badran, Silvina Bernasconi, Brenda Bacelar, Laura Morganti, Franco Garibaldi, Veronica Bermejo, Viviana Aguirre, Marcela Badia, Claudia G. Rodriguez" "autores" => array:14 [ 0 => array:2 [ "nombre" => "Ezequiel" "apellidos" => "Cordova" ] 1 => array:2 [ "nombre" => "M. Ines" "apellidos" => "Lespada" ] 2 => array:2 [ "nombre" => "Diego" "apellidos" => "Cecchini" ] 3 => array:2 [ "nombre" => "Fabiola" "apellidos" => "Nieto" ] 4 => array:2 [ "nombre" => "Susana" "apellidos" => "Palonski" ] 5 => array:2 [ "nombre" => "Mariana" "apellidos" => "Badran" ] 6 => array:2 [ "nombre" => "Silvina" "apellidos" => "Bernasconi" ] 7 => array:2 [ "nombre" => "Brenda" "apellidos" => "Bacelar" ] 8 => array:2 [ "nombre" => "Laura" "apellidos" => "Morganti" ] 9 => array:2 [ "nombre" => "Franco" "apellidos" => "Garibaldi" ] 10 => array:2 [ "nombre" => "Veronica" "apellidos" => "Bermejo" ] 11 => array:2 [ "nombre" => "Viviana" "apellidos" => "Aguirre" ] 12 => array:2 [ "nombre" => "Marcela" "apellidos" => "Badia" ] 13 => array:2 [ "nombre" => "Claudia G." "apellidos" => "Rodriguez" ] ] ] ] ] "idiomaDefecto" => "es" "Traduccion" => array:1 [ "en" => array:9 [ "pii" => "S2445146022000279" "doi" => "10.1016/j.vacune.2022.05.003" "estado" => "S300" "subdocumento" => "" "abierto" => array:3 [ "ES" => false "ES2" => false "LATM" => false ] "gratuito" => false "lecturas" => array:1 [ "total" => 0 ] "idiomaDefecto" => "en" "EPUB" => "https://multimedia.elsevier.es/PublicationsMultimediaV1/item/epub/S2445146022000279?idApp=UINPBA00004N" ] ] "EPUB" => "https://multimedia.elsevier.es/PublicationsMultimediaV1/item/epub/S1576988722000279?idApp=UINPBA00004N" "url" => "/15769887/00000023000000S1/v4_202403290955/S1576988722000279/v4_202403290955/es/main.assets" ] "en" => array:20 [ "idiomaDefecto" => true "cabecera" => "<span class="elsevierStyleTextfn">Original article</span>" "titulo" => "Analysis of SARS-CoV-2 mutations in the main viral protease (NSP5) and its implications on the vaccine designing strategies" "tieneTextoCompleto" => true "paginas" => array:1 [ 0 => array:2 [ "paginaInicial" => "S1" "paginaFinal" => "S13" ] ] "autores" => array:1 [ 0 => array:4 [ "autoresLista" => "Niti Yashvardhini, Amit Kumar, Deepak Kumar Jha" "autores" => array:3 [ 0 => array:3 [ "nombre" => "Niti" "apellidos" => "Yashvardhini" "referencia" => array:1 [ 0 => array:2 [ "etiqueta" => "<span class="elsevierStyleSup">a</span>" "identificador" => "af0005" ] ] ] 1 => array:3 [ "nombre" => "Amit" "apellidos" => "Kumar" "referencia" => array:1 [ 0 => array:2 [ "etiqueta" => "<span class="elsevierStyleSup">b</span>" "identificador" => "af0010" ] ] ] 2 => array:4 [ "nombre" => "Deepak Kumar" "apellidos" => "Jha" "email" => array:1 [ 0 => "deepakkumarjha01@gmail.com" ] "referencia" => array:3 [ 0 => array:2 [ "etiqueta" => "<span class="elsevierStyleSup">c</span>" "identificador" => "af0015" ] 1 => array:2 [ "etiqueta" => "<span class="elsevierStyleSup">*</span>" "identificador" => "cr0005" ] 2 => array:2 [ "etiqueta" => "<span class="elsevierStyleSup">1</span>" "identificador" => "fn0005" ] ] ] ] "afiliaciones" => array:3 [ 0 => array:3 [ "entidad" => "Department of Microbiology, Patna Women's College, Patna 800 001, India" "etiqueta" => "a" "identificador" => "af0005" ] 1 => array:3 [ "entidad" => "Department of Botany, Patna University, Patna 800 005, India" "etiqueta" => "b" "identificador" => "af0010" ] 2 => array:3 [ "entidad" => "Department of Zoology, P. C. Vigyan Mahavidyalaya, J. P. University, Chapra 841 301, India" "etiqueta" => "c" "identificador" => "af0015" ] ] "correspondencia" => array:1 [ 0 => array:3 [ "identificador" => "cr0005" "etiqueta" => "⁎" "correspondencia" => "Corresponding author." ] ] ] ] "titulosAlternativos" => array:1 [ "es" => array:1 [ "titulo" => "Análisis de las mutaciones del SARS-CoV-2 en la principal proteasa viral (NSP5) y sus implicaciones en las estrategias de diseño de vacunas" ] ] "resumenGrafico" => array:2 [ "original" => 0 "multimedia" => array:8 [ "identificador" => "f0010" "etiqueta" => "Fig. 2" "tipo" => "MULTIMEDIAFIGURA" "mostrarFloat" => true "mostrarDisplay" => false "figura" => array:3 [ 0 => array:1 [ "imagen" => "gr2a.jpeg" ] 1 => array:1 [ "imagen" => "gr2b.jpeg" ] 2 => array:1 [ "imagen" => "gr2c.jpeg" ] ] "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0010" "detalle" => "Fig. " "rol" => "short" ] ] "descripcion" => array:1 [ "en" => "<p id="sp0010" class="elsevierStyleSimplePara elsevierViewall">(a) Secondary structure prediction of NSP5 protein. Effect of mutation at different sites on the secondary structure of protease protein (A–H). The first secondary structure in each (A–F) represents the Wuhan type sequence while the second represents the mutated one. The mutation location and respective secondary structures are marked with boxes. (b) Mutational effect on structural dynamics of protease protein. Blue represents rigidification, whereas red represents gain in flexibility upon mutation. (c) Effect of point mutation on interatomic interactions of NSP5 protein. Interatomic interactions were altered by mutations at different locations. Wild type amino acid residues are colored in light green and represented as stick with the surrounding residues where any interactions exist. (For interpretation of the references to color in this figure legend, the reader is referred to the web version of this article.)</p>" ] ] ] "textoCompleto" => "<span class="elsevierStyleSections"><span id="s0005" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0020">Introduction</span><p id="p0005" class="elsevierStylePara elsevierViewall">The rapid emergence of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), responsible for causing the ongoing pandemic of novel coronavirus disease 2019 (COVID-19), induces moderate to severe respiratory distress (such as cough, cold, dyspnea) in humans around the world.<a class="elsevierStyleCrossRef" href="#bb0005"><span class="elsevierStyleSup">1</span></a> The novel COVID-19 has been reported from the wildlife market in Wuhan city of Hubei province (China), in late December 2019.<a class="elsevierStyleCrossRef" href="#bb0010"><span class="elsevierStyleSup">2</span></a> SARS-CoV-2 has now affected 218 countries, posing devastating public health threat across the globe. As of May 21, 2021, almost after 18 months of the outbreak of this pandemic worldwide over 107,838,255 confirmed cases of COVID-19 have been reported to WHO including 2,373,398 casualties (WHO COVID-19 Dashboard).<a class="elsevierStyleCrossRef" href="#bb0015"><span class="elsevierStyleSup">3</span></a> As many as 60 different vaccines against coronavirus have reached various stages of clinical development and many of them have been approved for immunization purposes nowadays. Vaccinating vulnerable population to achieve herd immunity against SARS-CoV-2 infection is of great importance, however, due to the emergence of new variants of this virus it is very difficult to assess how long the available vaccine will remain durable and effective.<a class="elsevierStyleCrossRef" href="#bb0020"><span class="elsevierStyleSup">4</span></a><span class="elsevierStyleSup">,</span><a class="elsevierStyleCrossRef" href="#bb0025"><span class="elsevierStyleSup">5</span></a></p><p id="p0010" class="elsevierStylePara elsevierViewall">Coronavirus (CoVs) is an enveloped, single-stranded, positive sense RNA virus of ~<span class="elsevierStyleHsp" style=""></span>30 kb length .<a class="elsevierStyleCrossRef" href="#bb0030"><span class="elsevierStyleSup">6</span></a> The genome of SARS-CoV-2 encodes four types of structural (spike S, envelope E, membrane M and nucleocapsid N) and various conserved non-structural proteins ranging from NSP1to NSP16 including nine accessory proteins.<a class="elsevierStyleCrossRef" href="#bb0035"><span class="elsevierStyleSup">7</span></a><span class="elsevierStyleSup">,</span><a class="elsevierStyleCrossRef" href="#bb0040"><span class="elsevierStyleSup">8</span></a> ORF1ab encodes non-structural proteins of SARS-CoV-2 which is crucial for the viral life cycle and pathogenesis. NSP5 (main viral protease, M<span class="elsevierStyleSup">pro</span>) has been found synonymous with 3C-like protease (3CL<span class="elsevierStyleSup">pro</span>), that mediates cleavage at 11 different sites of polyproteins to generate other non-structural proteins and also plays significant role in the viral replication cycle.<a class="elsevierStyleCrossRef" href="#bb0045"><span class="elsevierStyleSup">9</span></a><span class="elsevierStyleSup">,</span><a class="elsevierStyleCrossRef" href="#bb0050"><span class="elsevierStyleSup">10</span></a> Due to its essential and conserved role in viral development, NSP5 is considered as promising antiviral therapeutic target against SARS-CoV-2 infections. NSP5 of coronavirus is a ~<span class="elsevierStyleHsp" style=""></span>30 KDa protein, possessing structurally conserved three domain cysteine protease and acts as a main protease for proteolytic processing of viral replicase polyproteins such as pp1a and pp1b.<a class="elsevierStyleCrossRefs" href="#bb0055"><span class="elsevierStyleSup">11–14</span></a> Interestingly, the yields of NSPs proteins gets affected by the inhibition of the NSP5-mediated cleavage and hence, the viral replication can also be prevented. Due to this reason, since the advent of this pandemic, several studies have been performed to identify various compounds, capable to antagonize the activity of NSP5 and also help in better understanding of the molecular mechanism behind the inhibition.<a class="elsevierStyleCrossRef" href="#bb0075"><span class="elsevierStyleSup">15</span></a><span class="elsevierStyleSup">,</span><a class="elsevierStyleCrossRef" href="#bb0080"><span class="elsevierStyleSup">16</span></a></p><p id="p0015" class="elsevierStylePara elsevierViewall">The genome of SARS-CoV-2 is rapidly evolving by acquiring multiple mutations. As it is quite evident from numerous previous studies, NSP5 of coronavirus plays crucial role in the viral infection and pathogenesis. Present <span class="elsevierStyleItalic">in silico</span> study was, therefore, carried out to detect and characterize mutations of NSP5 of SARS-CoV-2. We identified a total of 33 mutations from 675 sequences submitted from India in the month of March 2020 to April 2021 and compared with the first reported sequence from Wuhan, as a reference sequence. Subsequently, the impact of mutation on the secondary structure and protein dynamics was observed that help in designing therapeutics and/or vaccine to curb SARS-CoV-2 infections.</p><p id="p0020" class="elsevierStylePara elsevierViewall">In addition to this, NSP5 of SARS-CoV-2 was explored to determine the potent antigenic epitopes of B-cell and T-cell with their MHC alleles to predict multiepitope vaccine (MEV) construct. Owing to their specificity, stability, less time-consuming and cost-effective properties as well as the ability to induce significant humoral and cellular immune responses, MEVs are found to be advantageous over single epitope or conventional vaccine development approach.<a class="elsevierStyleCrossRef" href="#bb0085"><span class="elsevierStyleSup">17</span></a> Further, several predictive tools of immunoinformatics were utilized to validate the non-allergenic, non-toxic, antigenicity, toxicity, structural stability/flexibility and physiochemical properties and hydrophobicity of the designed multi-epitopes vaccine candidate.</p></span><span id="s0010" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0025">Materials and methods</span><span id="s0015" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0030">Data mining</span><p id="p0025" class="elsevierStylePara elsevierViewall">The full length protein sequence of ORF1ab polyprotein, 7096 amino acid long which encodes for non-structural proteins in SARS-CoV-2 were retrieved from NCBI virus database. NCBI virus database keeps a deposit of all SARS-CoV-2 sequences submitted from different parts of the world. As on April 29, 2021, 675 full length ORF1ab amino acid sequences were submitted from India which was used in this study. The first reported ORF1ab protein sequence with Accession number YP_009724389 was also downloaded to be used as a reference or wild type sequence in this study. From the full length ORF1ab polyprotein sequence, the sequence of NSP5 (SARS-CoV-2 protease) was procured being 306 amino acid long.</p></span><span id="s0020" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0035">Identification of protease mutants from India</span><p id="p0030" class="elsevierStylePara elsevierViewall">To detect the variations in the protease protein amino acid sequences, the NSP5 protein sequences from India were aligned with the first reported SARS-CoV-2 sequence from Wuhan. To align these polypeptides, Clustal Omega online platform<a class="elsevierStyleCrossRef" href="#bb0090"><span class="elsevierStyleSup">18</span></a> was used which creates 1000 of alignments based on HMM profile seeded guide trees. These alignments were viewed on Jalview to detect the variations occurring in the protease protein with reference to Wuhan type protease sequence. The non-synonymous amino acid variants were analyzed using Protein Variation Effect Analyzer known as PROVEAN v1.1.3 with cutoff predicted score of −<span class="elsevierStyleHsp" style=""></span>2.50 to detect the effect of mutation on the NSP5 protein.<a class="elsevierStyleCrossRef" href="#bb0095"><span class="elsevierStyleSup">19</span></a> PROVEAN predicts the effect of amino acid substitution on the overall function of aa protein. A score namely delta alignment is calculated which are the PROVEAN scores of the substituted protein. The threshold limit for this score being −<span class="elsevierStyleHsp" style=""></span>2.5 below or equal to which the mutation is deleterious and above this threshold limit the variation has neutral effect.</p></span><span id="s0025" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0040">Calculation of physicochemical properties and hydropathy index of protease protein</span><p id="p0035" class="elsevierStylePara elsevierViewall">Physicochemical properties of any protein includes its molecular weight, aliphatic index, composition of different amino acids including positively and negatively charged, atomic composition, estimated half life, instability index, hydrophobicity (GRAVY score) and other parameters. These parameters were calculated using Protparam tool of Expasy online platform. The hydropathy plot was prepared using Protscale tool, an expasy program.<a class="elsevierStyleCrossRef" href="#bb0100"><span class="elsevierStyleSup">20</span></a></p></span><span id="s0030" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0045">Secondary structure prediction</span><p id="p0040" class="elsevierStylePara elsevierViewall">The secondary structure of the NSP5 protein was predicted using CFSSP (Chou and Fasman Secondary Structure Prediction) online software.<a class="elsevierStyleCrossRef" href="#bb0105"><span class="elsevierStyleSup">21</span></a> The analysis was done for both wild type and mutated protein sequences to study the alteration in the secondary structure of the protein such as changes in helix, turn and sheet formation due to mutation.</p></span><span id="s0035" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0050">NSP5 protein dynamics study</span><p id="p0045" class="elsevierStylePara elsevierViewall">Phyre2 online modeling platform was used to build the models of wild type and mutated NSP5 proteins.<a class="elsevierStyleCrossRef" href="#bb0110"><span class="elsevierStyleSup">22</span></a> Dynamut software was applied to detect the impact of mutation on the structure flexibility and dynamicity of NSP5 protein.<a class="elsevierStyleCrossRef" href="#bb0115"><span class="elsevierStyleSup">23</span></a> Dynamut computes information on the stability, NMA analysis, flexibility, rigidness, conformation of mutated as well as wild type protein. Several parameters were calculated like flexibility analysis, vibrational entropy, atomic and deformation energies using first 10 non-trivial modes of the structure. To check whether upon variation intramolecular interactions can change, Dynamut was used to predict the effect of mutation on intramolecular interactions.</p></span><span id="s0040" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0055">Identification of lineal B-cell epitopes</span><p id="p0050" class="elsevierStylePara elsevierViewall">IEDB was used to predict the lineal B-cell epitopes in the NSP5 protein of SARS-CoV-2.<a class="elsevierStyleCrossRef" href="#bb0120"><span class="elsevierStyleSup">24</span></a> IEDB webserver constructs epitopes based on estimation of parameters like flexibility, accessibility, hydrophilicity, turns, polarity and antigenic propensity of the protein using amino acid scales and HMMs.</p></span><span id="s0045" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0060">MHC class I allele identification</span><p id="p0055" class="elsevierStylePara elsevierViewall">The T-cell epitope binding alongwith the detection of MHC allele showing highest affinity for the T-cell epitope was predicted using IEDB Tepitool server.<a class="elsevierStyleCrossRef" href="#bb0120"><span class="elsevierStyleSup">24</span></a> This platform provides information on the binding of HLA allele with both type I and type II MHC molecules.</p></span><span id="s0050" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0065">Antigenicity and allergenicity evaluation</span><p id="p0060" class="elsevierStylePara elsevierViewall">To identify the antigenicity of the NSP5 protein, Vaxijen v2.0 server which predicts antigens according to the auto cross-covariance (ACC) transformation of the protein sequences was used.<a class="elsevierStyleCrossRef" href="#bb0125"><span class="elsevierStyleSup">25</span></a> The prediction of vaccine allergenicity was done using AllerTOP server, which evaluates protein allergenicity on auto cross variance (ACC method) that explains residues hydrophobicity, size, flexibility and other parameters.<a class="elsevierStyleCrossRef" href="#bb0130"><span class="elsevierStyleSup">26</span></a></p></span></span><span id="s0055" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0070">Results</span><span id="s0060" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0075">Identification of mutation in protease of SARS-CoV-2 and detection of non synonymous mutants</span><p id="p0065" class="elsevierStylePara elsevierViewall">Altogether 675 full length sequences of ORF1ab were submitted from India from March 2020 to April 2021. These 675 sequences were downloaded alongwith a reference sequence of Wuhan type virus from NCBI virus database (Supplementary table 1). The multiple sequence alignment was performed for all these ORF1ab sequences with reference to Wuhan type virus and the alignment file was viewed using Jalview. Those mutations which occurred in NSP5 were recorded and used for further analysis. A total of 33 point mutations were detected in this 306 amino acid long NSP5 protein of Indian isolates (Supplementary table 2). Amongst these point mutations, K236R, N142L, K90R, A7V, L75F, C22N, H246Y and I43V were the most frequently occurring mutations and hence used for further characterization in this study (Supplementary Fig. 1).</p><p id="p0070" class="elsevierStylePara elsevierViewall">The three non-synonymous amino acid substitutions (N142, L75F and C22N) amongst the eight showed deleterious impact on the structure and function of NSP5 protein. All other five mutants showed neutral impact on the protein at −<span class="elsevierStyleHsp" style=""></span>2.5 cutoff values of PROVEAN score (Supplementary table 3).</p></span><span id="s0065" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0080">Estimation of physicochemical properties and hydropathy index of SARS-CoV-2 NSP5 protein</span><p id="p0075" class="elsevierStylePara elsevierViewall">The physicochemical properties of SARS-CoV-2 protease protein were estimated using Protparam (ExPasy). The analysis revealed that the NSP5 protein is 306 amino acids in length with a molecular weight of 33,796.64 Da, instability index 27.65, aliphatic index 82.12 and GRAVY score of −<span class="elsevierStyleHsp" style=""></span>0.019 (<a class="elsevierStyleCrossRef" href="#t0005">Table 1</a>). The hydropathy plot showed C-terminal amino acid to be more hydrophobic as compared to the N-terminal end of NSP5 protein (<a class="elsevierStyleCrossRef" href="#f0005">Fig. 1</a>).</p><elsevierMultimedia ident="t0005"></elsevierMultimedia><elsevierMultimedia ident="f0005"></elsevierMultimedia></span><span id="s0070" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0085">Changes in secondary structure of NSP5 protein upon mutation</span><p id="p0080" class="elsevierStylePara elsevierViewall">To detect the alteration in formation and loss of alpha helix, beta sheet and turns upon mutation in NSP5 protein secondary structure prediction was done using CFSSP online program with respect to wild type protein. The mutations K236R, N142L, K90R, A7V, C22N and H246Y showed significant secondary structural changes (<a class="elsevierStyleCrossRef" href="#f0010">Fig. 2</a>a) and hence their effect was studied. The point mutation at position 236, where lysine is replaced by arginine in the NSP5 protein resulted in loss of helix structure at positions 235. Our analysis showed that the mutation at 142, where asparagine is replaced by leucine resulted in formation of helix and sheet at position 141 and loss of turn at 143. Asparagine being a polar uncharged amino acid favors formation of turn, whereas leucine being a non polar amino acid forms helix. Further, the substitution of lysine by arginine at position 90 resulted in loss of helix and sheet at points 91, 92 and 93. The A7V mutant resulted in formation of sheet at positions 3, 4, 5, 6 and 7 as valine has larger non-polar group compared to alanine and hence more tendency to form sheets. C22N mutant showed formation of turn at point 22, as asparagines favors turn formation. The substitution of histidine by tyrosine at 246 position resulted in loss of helix at 242 and 243 positions. Tyrosine being an aromatic amino acid has more tendencies to form sheets rather than helix. Overall, the secondary structure analysis depicts significant changes in the formation and loss of helix, sheet and turn that can bring huge impact on NSP5 protein and hence leading to the SARS-CoV-2 multiplication and infection.</p><elsevierMultimedia ident="f0010"></elsevierMultimedia></span><span id="s0075" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0090">Protein modeling and structure prediction</span><p id="p0085" class="elsevierStylePara elsevierViewall">The 3D model of NSP5 protein was built using Phyre2 online modeling software, which performs modeling on the basis of template search. The template being used for protease protein was d2duca1 with 100% similarity coverage. The models of both wild type and mutated NSP5 protein sequences are shown in Supplementary Fig. 2.</p></span><span id="s0080" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0095">NSP5 protein flexibility and stability change upon mutation</span><p id="p0090" class="elsevierStylePara elsevierViewall">The impact of mutation on the dynamics of protease protein was estimated using Dynamut software.<a class="elsevierStyleCrossRef" href="#bb0115"><span class="elsevierStyleSup">23</span></a> Dynamut software estimates the flexibility or steadiness of a protein upon mutation as compared to the wild type as calculated by ENCoM, DUET, mCSM and others. Negative value of ΔΔG denotes destabilization of protein upon mutation, whereas a positive value signifies stabilization. The free energy difference, ∆∆G between the wild and mutated protein sequences was calculated using Dynamut and the values showed a stabilizing mutation in five mutants of NSP5 protein as indicated by their ∆∆G values (<a class="elsevierStyleCrossRef" href="#t0010">Table 2</a>). The mutants N142L, H246Y and I43V were destabilizing for NSP5 protein with -∆∆G values. The most stable mutant amongst all was L75F showing highest positive value of ∆∆G (1.200 kcal/mol), followed by C22N (0.884 kcal/mol) and A7V (0.653 kcal/mol) as shown in <a class="elsevierStyleCrossRef" href="#t0020">Table 4</a>. The highest negative value of ∆∆G was shown by I43V (−<span class="elsevierStyleHsp" style=""></span>1.002 kcal/mol) followed by N142L (−<span class="elsevierStyleHsp" style=""></span>0.029 kcal/mol) and H246Y (−<span class="elsevierStyleHsp" style=""></span>0.028 kcal/mol). The vibrational entropy change (ΔΔS<span class="elsevierStyleInf">Vib</span> ENCoM) provides information on the configurational entropy of the proteins with single minima of the energy landscape. The ΔΔS<span class="elsevierStyleInf">Vib</span> ENCoM was calculated for the mutant and wild type protease protein to calculate the vibrational entropy energy change between wild type and mutant. The ΔΔS<span class="elsevierStyleInf">Vib</span> ENCoM calculated for all the protease mutants revealed a negative value signifying the rigidification of protein structure upon mutation except for I43V and K90R mutant which have positive values of ΔΔS<span class="elsevierStyleInf">Vib</span> ENCoM, signifying gain of flexibility upon mutation in NSP5 protein. The visual representation of flexibility analysis depicted similar results, of gain in rigidification upon mutation shown by blue region in all the NSP5 mutants except for I43V and K90R mutants, shown by red color region in <a class="elsevierStyleCrossRef" href="#f0010">Fig. 2</a>c.</p><elsevierMultimedia ident="t0010"></elsevierMultimedia><p id="p0095" class="elsevierStylePara elsevierViewall">Further, the findings of our study dealt with the detection of variation in intramolecular interactions of NSP5 protein with its neighboring molecules upon mutation. All the NSP5 mutants studied here showed significant changes in intramolecular interactions that occurred in NSP5 proteins upon mutation (<a class="elsevierStyleCrossRef" href="#f0010">Fig. 2</a>d). The mutation caused significant alterations in the interactions like hydrogen bonds, ionic interactions, hydrophobic interactions and other metal complex interactions. The substitution in side chain of the amino acids changes due to mutation hence disrupting neighboring interactions. This study predicts that the mutation in leucine, asparagines, lysine, cysteine, alanine residues causes significant alterations in the intramolecular interactions with the neighboring molecules (<a class="elsevierStyleCrossRef" href="#f0010">Fig. 2</a>d). From these results, it can be concluded that the NSP5 protein mutation not only changes the overall dynamics of the protein but can also interrupts its intramolecular interaction.</p></span><span id="s0085" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0100">B-cell epitope prediction with its antigenicity and allergenicity</span><p id="p0100" class="elsevierStylePara elsevierViewall">Lineal B-cell epitopes were predicted for NSP5 protein using NSP5 protein sequence as query and threshold value of 0.5 was selected. A total of eight B-cell epitopes predicted for this protein above the threshold value which are shown in <a class="elsevierStyleCrossRef" href="#t0015">Table 3</a> (<a class="elsevierStyleCrossRef" href="#f0015">Fig. 3</a>). Out of these nine epitopes, the epitopes KMAFPSGKV, EDMLNPNYEDL, QNGMNG and EFTPFDVVR were highly antigenic as well as non-allergenic, whereas some epitopes were immunogenic but allergenic. These five predicted epitopes can be a good candidate in vaccine production against SARS-CoV-2. In our analysis, 9 mutations out of 33 were found in the epitopic region of protease protein. These mutations not only change its epitopic region rather changes its overall antigenicity and therefore can help in host evasion.</p><elsevierMultimedia ident="t0015"></elsevierMultimedia><elsevierMultimedia ident="f0015"></elsevierMultimedia></span><span id="s0090" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0105">Prediciton of T-cell epitope and MHC class I immunogenicity</span><p id="p0105" class="elsevierStylePara elsevierViewall">Altogether 9 T-cell binding epitopes were predicted for NSP5 protein showing different allele binding affinity. The sequence of these epitopes along with its position is shown in <a class="elsevierStyleCrossRef" href="#t0020">Table 4</a>. Out of these nine T-cell epitopes only two were allergenic and others were immunogenic as well as non-allergenic. The MHC class I immunogenicity of the NSP5 molecules is shown in <a class="elsevierStyleCrossRef" href="#t0025">Table 5</a>. A total of six peptides were predicted with a potential of MHC class I immunogens. These epitopes can induce immunogenicity and hence increase cytokine production in cells to combat the infection.</p><elsevierMultimedia ident="t0020"></elsevierMultimedia><elsevierMultimedia ident="t0025"></elsevierMultimedia></span><span id="s0095" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0110">Cluster analysis of MHC alleles</span><p id="p0110" class="elsevierStylePara elsevierViewall">The cluster analysis of MHC class I allele is shown in <a class="elsevierStyleCrossRef" href="#f0015">Fig. 3</a>c while that of class II allele is shown in <a class="elsevierStyleCrossRef" href="#f0015">Fig. 3</a>d, where the red zone denotes strong interaction of the HLA allele with the epitopes of NSP5 protein, whereas yellow depicts weak interaction. We analyzed the binding ability of all the alleles with the protease epitopes.</p></span><span id="s0100" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0115">Assessment of antigenicity and allergenicity</span><p id="p0115" class="elsevierStylePara elsevierViewall">VaxiJen v2.0 server was used to predict the antigenicity of the protease protein. The property of antigenicity depends on the ability of the vaccine to bind to the B-cell and T-cell receptors and increase the immune response in the cell. This analysis indicates that the NSP5 protein sequence is antigenic with potent antigenicity at a threshold of 0.4%. A good immunogen should not show allergic response in the host cell. The allergenicity of B-cell epitopes of the NSP5 protein was predicted using Allertop tool as many B-cell and T-cell epitopes were non-allergenic and hence can be a candidate protein for vaccine development.</p></span></span><span id="s0105" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0120">Discussion</span><p id="p0120" class="elsevierStylePara elsevierViewall">Coronavirus poses an unprecedented threat for human health globally. Considering its contagiousity, World Health Organization on March 11, 2020 has declared public health emergency internationally (WHO 2020). SARS-CoV-2 is a member of RNA viruses and has remarkable capacity to mutate their genome in a very short period of time.<a class="elsevierStyleCrossRef" href="#bb0135"><span class="elsevierStyleSup">27</span></a> Notably, majority of viral mutation shows harmful effects. Moreover, a mutation is essential for viral evolution and adaptability, these traits are considered as the key determinants for viruses to survive in the dynamic environment of host and also enabling them to evade the pre-existing immunity of host and most often acquire drug resistance. SARS-CoV-2 infections emerged from Wuhan, China, soon began to spread globally. Rapid transmission of coronavirus infection depends on various factors such as polymerase fidelity, different geographical areas and population density, as well as poor health care system, climatic and environmental variations.<a class="elsevierStyleCrossRef" href="#bb0140"><span class="elsevierStyleSup">28</span></a> Mutational analysis of SARS-CoV-2 provides better understanding of its epidemiology, pathogenesis and to devise antiviral therapeutic strategies against COVID-19.</p><p id="p0125" class="elsevierStylePara elsevierViewall">The results of our study revealed, a total of 33 mutations identified from 675 sequences of NSP5 (main viral protease) from India. Amongst these mutations, three were non-synonymous amino acid substitutions (N142, L75F and C22N), whereas others showed deleterious impact on the structure and function of NSP5 protein. The mutations K236R, N142L, K90R, A7V, C22N and H246Y showed significant alterations in the secondary structure of NSP5 protein. The mutations N142L, H246Y and I43V were destabilizing and possess -∆∆G values. All NSP5 mutants except for I43V and K90R mutant (positive values) showed negative values of ΔΔS<span class="elsevierStyleInf">Vib</span> ENCoM and hence resulted in rigidification of protein structure. Due to these mutations, considerable alterations were observed at several positions that also affect its stability and dynamicity which in turn altered the function of NSP5. Roe et al<a class="elsevierStyleCrossRef" href="#bb0145"><span class="elsevierStyleSup">29</span></a> have reported that NSP5 are capable to make associatation with several other components of replication complex. Earlier studies have also revealed that important intra- and intermolecular interaction exist between the main viral protease NSP5 and other replicase gene, with mutation in the NSP5 domain as well as in the NSP3 and NSP10 which negatively affecting the activity of NSP5.<a class="elsevierStyleCrossRefs" href="#bb0145"><span class="elsevierStyleSup">29–31</span></a>The design and development of vaccine gained much attention nowadays including the multiepitope, DNA as well as RNA-based vaccines for various infectious diseases (such as influenza virus, Ervebo virus), using predictive tools of immunoinformatics have become the major research priority. The conventional methods of vaccine designing strategies include experimental identification, establishing immunological correlation with the coronavirus to develop potential vaccine construct. For the structural activities of SARS-CoV-2, proteins are supposed to be important constituent involved in the viral infection, entry and replication. The findings of earlier studies suggested that protein could be a very good target for developing vaccine against SARS-CoV-2.<a class="elsevierStyleCrossRefs" href="#bb0160"><span class="elsevierStyleSup">32–34</span></a> Additionally, for a peptide vaccine to be highly immunogenic B-cell epitope of its target molecule must interact with a T-cell immune epitope. The T-cell epitopes is made up of short fragments of peptide and hence appeared as more propitious, which generate long-term immune response mediated by CD8<span class="elsevierStyleHsp" style=""></span>+ T-cells.<a class="elsevierStyleCrossRef" href="#bb0030"><span class="elsevierStyleSup">6</span></a> In contrast, the B-cell epitopes consists of lineal chain of amino acid.<a class="elsevierStyleCrossRef" href="#bb0175"><span class="elsevierStyleSup">35</span></a><span class="elsevierStyleSup">,</span><a class="elsevierStyleCrossRef" href="#bb0180"><span class="elsevierStyleSup">36</span></a></p><p id="p0130" class="elsevierStylePara elsevierViewall">The epitope selection based on immunogenic features like antigenicity, allergenicity and toxicity. Similarly, the predicted antigenic determinants (epitopes) of MHC class-I showed interaction with the several HLA alleles and, therefore, found to be antigenic. The hydropathy index and physiochemical properties of SARS-CoV-2 NSP5 protein were also estimated which revealed that protein is stable and can form non-covalent bonds (such as hydrogen bonds) with other protein molecules. The present <span class="elsevierStyleItalic">in silico</span> study was found consistent with the previous studies based on immunoinformatics approach for the design and developments of novel therapeutic intervention and/or vaccine against COVID-19.<a class="elsevierStyleCrossRefs" href="#bb0185"><span class="elsevierStyleSup">37–40</span></a></p><p id="p0135" class="elsevierStylePara elsevierViewall">In this study, we investigated the NSP5, as a potent immunogenic epitopes which elevates prolonged humoral (B-cell) as well as cell-mediated (T-cell) immune response to counteract viral particles, and hence serves as a potential candidate vaccine. A total of eight B-cell and T-cell epitopes were predicted for NSP5 proteins, amongst which the epitopes KMAFPSGKV, EDMLNPNYEDL, QNGMNG and EFTPFDVVR were highly immunogenic as well as non-allergenic. Primarily, the efficacy of vaccine candidates relies on the selection of its antigen molecules.<a class="elsevierStyleCrossRef" href="#bb0205"><span class="elsevierStyleSup">41</span></a> The data obtained from our study also corroborates the previous findings. Earlier studies on SARS-CoV and MERS-CoV have shown that the S glycoprotein can induce antibodies to neutralize virus infection by blocking virus binding as well as its fusion to the host cell.<a class="elsevierStyleCrossRefs" href="#bb0205"><span class="elsevierStyleSup">41,42</span></a> Yashvardhini et al<a class="elsevierStyleCrossRef" href="#bb0085"><span class="elsevierStyleSup">17</span></a> have also reported that multiepitopes-based peptide vaccines are safe and specific that need adjuvants to show high levels of immunogenicity.</p><p id="p0140" class="elsevierStylePara elsevierViewall">In the present study, occurrence of recurrent mutations in the main viral protease (NSP5) of coronavirus elucidates structural alteration that might affect its functions. Using predictive tools of computational biology, we also predicted promising epitope based vaccine candidates that are capable to stimulate both humoral (B-cell) as well as cellular (T-cell) immune responses. However, our <span class="elsevierStyleItalic">in silico</span> designed vaccine construct showed high efficacy and, therefore, suggested as good candidate against SARS-CoV-2 infections. Moreover, further <span class="elsevierStyleItalic">in vivo</span> and <span class="elsevierStyleItalic">in vitro</span> studies are mandatory to validate the durability and efficacy of designed vaccine candidate.</p></span><span id="s0110" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0125">Conclusion</span><p id="p0145" class="elsevierStylePara elsevierViewall">Occurrence of recurrent mutations in the NSP5 of SARS-CoV-2 provides a deep insight in the identification and magnitude of virulence properties. The study also suggests continues molecular surveillances of novel coronavirus that might be useful in the development of ongoing biomedical intervention to curb this contagious disease. For the design and development of candidate vaccine, NSP5 of coronavirus has been chosen as potentially ideal target molecule because NSP5 is the main viral protease of SARS-CoV-2 and plays an important role in the viral replication cycle. Moreover, our study sheds light on, high efficacy and durability of designed epitopes vaccine candidate applying various predictive tools of immunoinformatics; further, <span class="elsevierStyleItalic">in vivo</span> and <span class="elsevierStyleItalic">in vitro</span> studies are mandatory to validate designed candidate vaccine.</p><p id="p0150" class="elsevierStylePara elsevierViewextended">The following are the supplementary data related to this article.<elsevierMultimedia ident="ec0005"></elsevierMultimedia><elsevierMultimedia ident="ec0010"></elsevierMultimedia><elsevierMultimedia ident="ec0015"></elsevierMultimedia><elsevierMultimedia ident="ec0020"></elsevierMultimedia><elsevierMultimedia ident="ec0025"></elsevierMultimedia></p><p id="p0155" class="elsevierStylePara elsevierViewcompact-standard">Supplementary data to this article can be found online at <a href="https://doi.org/10.1016/j.vacun.2021.10.002">https://doi.org/10.1016/j.vacun.2021.10.002</a>.</p></span><span id="s0115" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0130">Trial registration number (if clinical trial)</span><p id="p0160" class="elsevierStylePara elsevierViewall">None.</p></span><span id="s0120" class="elsevierStyleSection elsevierViewall"><span class="elsevierStyleSectionTitle" id="st0135">Funding</span><p id="p0165" class="elsevierStylePara elsevierViewall">Nil.</p></span></span>" "textoCompletoSecciones" => array:1 [ "secciones" => array:12 [ 0 => array:3 [ "identificador" => "xres2115606" "titulo" => "Abstract" "secciones" => array:1 [ 0 => array:1 [ "identificador" => "as0005" ] ] ] 1 => array:2 [ "identificador" => "xpalclavsec1802289" "titulo" => "Palabras clave" ] 2 => array:3 [ "identificador" => "xres2115605" "titulo" => "Resumen" "secciones" => array:1 [ 0 => array:1 [ "identificador" => "as0010" ] ] ] 3 => array:2 [ "identificador" => "xpalclavsec1802288" "titulo" => "Keywords" ] 4 => array:2 [ "identificador" => "s0005" "titulo" => "Introduction" ] 5 => array:3 [ "identificador" => "s0010" "titulo" => "Materials and methods" "secciones" => array:8 [ 0 => array:2 [ "identificador" => "s0015" "titulo" => "Data mining" ] 1 => array:2 [ "identificador" => "s0020" "titulo" => "Identification of protease mutants from India" ] 2 => array:2 [ "identificador" => "s0025" "titulo" => "Calculation of physicochemical properties and hydropathy index of protease protein" ] 3 => array:2 [ "identificador" => "s0030" "titulo" => "Secondary structure prediction" ] 4 => array:2 [ "identificador" => "s0035" "titulo" => "NSP5 protein dynamics study" ] 5 => array:2 [ "identificador" => "s0040" "titulo" => "Identification of lineal B-cell epitopes" ] 6 => array:2 [ "identificador" => "s0045" "titulo" => "MHC class I allele identification" ] 7 => array:2 [ "identificador" => "s0050" "titulo" => "Antigenicity and allergenicity evaluation" ] ] ] 6 => array:3 [ "identificador" => "s0055" "titulo" => "Results" "secciones" => array:9 [ 0 => array:2 [ "identificador" => "s0060" "titulo" => "Identification of mutation in protease of SARS-CoV-2 and detection of non synonymous mutants" ] 1 => array:2 [ "identificador" => "s0065" "titulo" => "Estimation of physicochemical properties and hydropathy index of SARS-CoV-2 NSP5 protein" ] 2 => array:2 [ "identificador" => "s0070" "titulo" => "Changes in secondary structure of NSP5 protein upon mutation" ] 3 => array:2 [ "identificador" => "s0075" "titulo" => "Protein modeling and structure prediction" ] 4 => array:2 [ "identificador" => "s0080" "titulo" => "NSP5 protein flexibility and stability change upon mutation" ] 5 => array:2 [ "identificador" => "s0085" "titulo" => "B-cell epitope prediction with its antigenicity and allergenicity" ] 6 => array:2 [ "identificador" => "s0090" "titulo" => "Prediciton of T-cell epitope and MHC class I immunogenicity" ] 7 => array:2 [ "identificador" => "s0095" "titulo" => "Cluster analysis of MHC alleles" ] 8 => array:2 [ "identificador" => "s0100" "titulo" => "Assessment of antigenicity and allergenicity" ] ] ] 7 => array:2 [ "identificador" => "s0105" "titulo" => "Discussion" ] 8 => array:2 [ "identificador" => "s0110" "titulo" => "Conclusion" ] 9 => array:2 [ "identificador" => "s0115" "titulo" => "Trial registration number (if clinical trial)" ] 10 => array:2 [ "identificador" => "s0120" "titulo" => "Funding" ] 11 => array:1 [ "titulo" => "References" ] ] ] "pdfFichero" => "main.pdf" "tienePdf" => true "fechaRecibido" => "2021-05-28" "fechaAceptado" => "2021-10-26" "PalabrasClave" => array:1 [ "en" => array:1 [ 0 => array:4 [ "clase" => "keyword" "titulo" => "Palabras clave" "identificador" => "xpalclavsec1802289" "palabras" => array:6 [ 0 => "SARS-CoV-2" 1 => "Pandemia" 2 => "Epítopos" 3 => "NSP5" 4 => "Mutación" 5 => "Vacuna" ] ] ] ] "tieneResumen" => true "resumen" => array:2 [ "en" => array:2 [ "titulo" => "Abstract" "resumen" => "<span id="as0005" class="elsevierStyleSection elsevierViewall"><p id="sp0045" class="elsevierStyleSimplePara elsevierViewall">SARS-CoV-2 (Severe Acute Respiratory Syndrome), an etiolating agent of novel COVID-19 (coronavirus 2019) pandemic, rapidly spread worldwide, creating an unprecedented public health crisis globally. NSP5, the main viral protease, is a highly conserved protein, encoded by the genome of SARS-CoV-2 and plays an important role in the viral replication cycle. In the present study, we detected a total of 33 mutations from 675 sequences submitted from India in the month of March 2020 to April 2021. Out of 33 mutations, we selected 8 frequent mutations (K236R, N142L, K90R, A7V, L75F, C22N, H246Y and I43V) for further analysis. Subsequently, protein models were constructed, revealing significant alterations in the 3-D structure of NSP5 protein when compared to the wild type protein sequence which also altered the secondary structure of NSP5 protein. Further, we identified 9 B-cell, 10 T-cell and 6 MHC-I promising epitopes using predictive tools of immunoinformatics, out of these epitopes some were non-allergenic as well as highly immunogenic. Results of our study, however, revealed that 10 B-cell epitopes reside in the mutated region of NSP5. Additionally, hydrophobicity, physiochemical properties, toxicity and stability of NSP5 protein were estimated to demonstrate the specificity of the multiepitope candidates. Taken together, variations arising as a consequence of multiple mutations may cause alterations in the structure and function of NSP5 which generate crucial insights to better understand structural aspects of SARS-CoV-2. Our study also revealed, NSP5, a main protease, can be a potentially good target for the design and development of vaccine candidate against SARS-CoV-2.</p></span>" ] "es" => array:2 [ "titulo" => "Resumen" "resumen" => "<span id="as0010" class="elsevierStyleSection elsevierViewall"><p id="sp0050" class="elsevierStyleSimplePara elsevierViewall">El SARS-CoV-2 (Síndrome Respiratorio Agudo Severo), un agente etiológico de la nueva pandemia de COVID-19 (coronavirus 2019), se propagó rápidamente por todo el mundo y creó una crisis de salud pública sin precedentes a nivel mundial. El NSP5, la proteasa viral principal, es una proteína altamente conservada, codificada por el genoma del SARS-CoV-2 y juega un papel importante en el ciclo de replicación viral. En el presente estudio se detectaron un total de 33 mutaciones de 675 secuencias presentadas desde la India en el mes de marzo de 2020 a abril de 2021. De 33 mutaciones, se seleccionaron 8 mutaciones frecuentes (K236R, N142L, K90R, A7V, L75F, C22N, H246Y e I43V) para su posterior análisis. Posteriormente, se construyeron modelos proteicos que revelaron alteraciones significativas en la estructura 3D de las proteínas NSP5 en comparación con la secuencia de proteínas de tipo silvestre que también alteraron la estructura secundaria de la proteína NSP5. Además, se identificaron 9 epítopos prometedores de células B, 10 de células T y 6 de MHC-I, utilizando herramientas predictivas de inmunoinformática, algunos no alergénicos y altamente inmunogénicos. Los resultados de nuestro estudio, sin embargo, revelaron que 10 epítopos de células B residen en la región mutada de NSP5. Adicionalmente, se estimó la hidrofobicidad, propiedades fisicoquímicas, toxicidad y estabilidad de la proteína NSP5 para demostrar la especificidad de los candidatos multiepítopos. En conjunto, las variaciones que surgen como consecuencia de múltiples mutaciones pueden causar alteraciones en la estructura y función del NSP5 que generan conocimientos cruciales para entender mejor los aspectos estructurales del SARS-CoV-2. Nuestro estudio también reveló que el NSP5, una proteasa principal, puede ser un blanco potencialmente bueno para el diseño y desarrollo de la vacuna candidata contra el SARS-CoV-2.</p></span>" ] ] "NotaPie" => array:1 [ 0 => array:3 [ "etiqueta" => "1" "nota" => "<p class="elsevierStyleNotepara" id="np0005">Equally contributed</p>" "identificador" => "fn0005" ] ] "multimedia" => array:13 [ 0 => array:8 [ "identificador" => "f0005" "etiqueta" => "Fig. 1" "tipo" => "MULTIMEDIAFIGURA" "mostrarFloat" => true "mostrarDisplay" => false "figura" => array:1 [ 0 => array:4 [ "imagen" => "gr1.jpeg" "Alto" => 692 "Ancho" => 925 "Tamanyo" => 99867 ] ] "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0005" "detalle" => "Fig. " "rol" => "short" ] ] "descripcion" => array:1 [ "en" => "<p id="sp0005" class="elsevierStyleSimplePara elsevierViewall">Hydropathy plot of wild type protease protein showing hydrophobic amino acid residues.</p>" ] ] 1 => array:8 [ "identificador" => "f0010" "etiqueta" => "Fig. 2" "tipo" => "MULTIMEDIAFIGURA" "mostrarFloat" => true "mostrarDisplay" => false "figura" => array:3 [ 0 => array:1 [ "imagen" => "gr2a.jpeg" ] 1 => array:1 [ "imagen" => "gr2b.jpeg" ] 2 => array:1 [ "imagen" => "gr2c.jpeg" ] ] "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0010" "detalle" => "Fig. " "rol" => "short" ] ] "descripcion" => array:1 [ "en" => "<p id="sp0010" class="elsevierStyleSimplePara elsevierViewall">(a) Secondary structure prediction of NSP5 protein. Effect of mutation at different sites on the secondary structure of protease protein (A–H). The first secondary structure in each (A–F) represents the Wuhan type sequence while the second represents the mutated one. The mutation location and respective secondary structures are marked with boxes. (b) Mutational effect on structural dynamics of protease protein. Blue represents rigidification, whereas red represents gain in flexibility upon mutation. (c) Effect of point mutation on interatomic interactions of NSP5 protein. Interatomic interactions were altered by mutations at different locations. Wild type amino acid residues are colored in light green and represented as stick with the surrounding residues where any interactions exist. (For interpretation of the references to color in this figure legend, the reader is referred to the web version of this article.)</p>" ] ] 2 => array:8 [ "identificador" => "f0015" "etiqueta" => "Fig. 3" "tipo" => "MULTIMEDIAFIGURA" "mostrarFloat" => true "mostrarDisplay" => false "figura" => array:3 [ 0 => array:1 [ "imagen" => "gr3a.jpeg" ] 1 => array:1 [ "imagen" => "gr3b.jpeg" ] 2 => array:1 [ "imagen" => "gr3c.jpeg" ] ] "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0015" "detalle" => "Fig. " "rol" => "short" ] ] "descripcion" => array:1 [ "en" => "<p id="sp0015" class="elsevierStyleSimplePara elsevierViewall">(a) B-cell epitope prediction of NSP5 protein. The threshold cutoff is 0.5 above which the residues are epitopes. (b) The results of MHC cluster analysis. (A) Heat map of MHC class I cluster, (B) tree map of MHC class I cluster. (c) The results of MHC cluster analysis. (A) Heat map of MHC class II cluster, (B) tree map of MHC class II cluster.</p>" ] ] 3 => array:8 [ "identificador" => "t0005" "etiqueta" => "Table 1" "tipo" => "MULTIMEDIATABLA" "mostrarFloat" => true "mostrarDisplay" => false "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0020" "detalle" => "Table " "rol" => "short" ] ] "tabla" => array:1 [ "tablatextoimagen" => array:1 [ 0 => array:2 [ "tabla" => array:1 [ 0 => """ <table border="0" frame="\n \t\t\t\t\tvoid\n \t\t\t\t" class=""><thead title="thead"><tr title="table-row"><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Physicochemical properties \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Protease \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Amino acid composition \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">No. \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Percent composition (%) \t\t\t\t\t\t\n \t\t\t\t\t\t</th></tr></thead><tbody title="tbody"><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Molecular weight \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">33,796.64 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Ala (A) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">17 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">5.6 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">No. of amino acids \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">306 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Arg (R) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">11 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3.6 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Theoretical pI \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">5.95 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Asn (N) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">21 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">6.9 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Instability index \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">27.65 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Asp (D) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">17 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">65. \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">No. of negatively charged (Asp<span class="elsevierStyleHsp" style=""></span>+ Glu) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">26 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Cys (C) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">12 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3.9 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">No. of positively charged (Arg + Lys) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">22 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Gln (Q) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">14 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">4.6 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">aliphatic index \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">82.12 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Glu (E) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">9 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">2.9 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Grand average of hydropathicity \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.019 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Gly (G) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">26 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">8.5 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Estimated half-life (mammalian reticulocytes, <span class="elsevierStyleItalic">in vitro</span>) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.9 h \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">His (H) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">7 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">2.3 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Atomic composition \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Ile (I) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">11 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3.6 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">C \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1499 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Leu (L) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">29 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">9.5 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">H \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">2318 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Lys (K) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">11 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3.6 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">N \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">402 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Met (M) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">10 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3.3 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">O \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">445 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Phe (F) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">17 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">5.6 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">S \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">22 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Pro (P) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">13 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">4.2 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Formula \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">C<span class="elsevierStyleInf">1499</span>H<span class="elsevierStyleInf">2318</span>N<span class="elsevierStyleInf">402</span>O<span class="elsevierStyleInf">445</span>S<span class="elsevierStyleInf">22</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Ser (S) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">16 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">5.2 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Total number of atoms \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">4686 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Thr (T) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">24 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">7.8 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Trp (W) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.0 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Tyr (Y) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">11 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3.6 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Val (V) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">27 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">8.8 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Phy (O) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.0 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t"> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Sec (U) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.0 \t\t\t\t\t\t\n \t\t\t\t</td></tr></tbody></table> """ ] "imagenFichero" => array:1 [ 0 => "xTab3498259.png" ] ] ] ] "descripcion" => array:1 [ "en" => "<p id="sp0020" class="elsevierStyleSimplePara elsevierViewall">Physicochemical properties of NSP5 protein (wild type).</p>" ] ] 4 => array:8 [ "identificador" => "t0010" "etiqueta" => "Table 2" "tipo" => "MULTIMEDIATABLA" "mostrarFloat" => true "mostrarDisplay" => false "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0025" "detalle" => "Table " "rol" => "short" ] ] "tabla" => array:1 [ "tablatextoimagen" => array:1 [ 0 => array:2 [ "tabla" => array:1 [ 0 => """ <table border="0" frame="\n \t\t\t\t\tvoid\n \t\t\t\t" class=""><thead title="thead"><tr title="table-row"><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">S. no. \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Wuhan isolate \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Indian isolates \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Amino acid position \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">ΔΔG Dynamut \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">ΔΔS ENCoM \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">ΔΔG ENCoM \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Mutation type \t\t\t\t\t\t\n \t\t\t\t\t\t</th></tr></thead><tbody title="tbody"><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1. \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">K \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">R \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">236 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.441 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.138 kcal.mol<span class="elsevierStyleSup">−1</span> K<span class="elsevierStyleSup">−1</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.110 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Stabilizing \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">2. \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">N \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">L \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">142 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">-0.029 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.052 kcal.mol<span class="elsevierStyleSup">−1</span> K<span class="elsevierStyleSup">−1</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.041 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Destabilizing \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3. \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">K \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">R \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">90 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.456 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.125 kcal.mol<span class="elsevierStyleSup">−1</span> K<span class="elsevierStyleSup">−1</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.100 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Stabilizing \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">4. \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">A \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">V \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">7 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.653 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.472 kcal.mol<span class="elsevierStyleSup">−1</span> K<span class="elsevierStyleSup">−1</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.377 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Stabilizing \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">5. \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">L \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">F \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">75 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.200 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.322 kcal.mol<span class="elsevierStyleSup">−1</span> K<span class="elsevierStyleSup">−1</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.258 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Stabilizing \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">6. \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">C \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">N \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">22 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.884 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.030 kcal.mol<span class="elsevierStyleSup">−1</span> K<span class="elsevierStyleSup">−1</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.024 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Stabilizing \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">7. \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">H \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Y \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">246 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.028 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.108 kcal.mol<span class="elsevierStyleSup">−1</span> K<span class="elsevierStyleSup">−1</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.087 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Destabilizing \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">8. \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">I \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">V \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">43 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>1.002 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.253 kcal.mol<span class="elsevierStyleSup">−1</span> K<span class="elsevierStyleSup">−1</span> \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.202 kcal/mol \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Destabilizing \t\t\t\t\t\t\n \t\t\t\t</td></tr></tbody></table> """ ] "imagenFichero" => array:1 [ 0 => "xTab3498256.png" ] ] ] ] "descripcion" => array:1 [ "en" => "<p id="sp0025" class="elsevierStyleSimplePara elsevierViewall">Effect of mutation on the structural dynamics of protease protein as shown by ΔΔS ENCoM and ΔΔG values.</p>" ] ] 5 => array:8 [ "identificador" => "t0015" "etiqueta" => "Table 3" "tipo" => "MULTIMEDIATABLA" "mostrarFloat" => true "mostrarDisplay" => false "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0030" "detalle" => "Table " "rol" => "short" ] ] "tabla" => array:1 [ "tablatextoimagen" => array:1 [ 0 => array:2 [ "tabla" => array:1 [ 0 => """ <table border="0" frame="\n \t\t\t\t\tvoid\n \t\t\t\t" class=""><thead title="thead"><tr title="table-row"><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">No. \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Start \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">End \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Peptide \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Length \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Antigenicity \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Allergenicity \t\t\t\t\t\t\n \t\t\t\t\t\t</th></tr></thead><tbody title="tbody"><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">5 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">13 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">KMAFPSGKV \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">9 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.6043 (Probable antigen) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">2 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">47 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">57 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">EDMLNPNYEDL \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">11 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.091(Probable antigen) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">3 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">93 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">109 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">TANPKTPKYKFVRIQPG \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">17 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.145(Probable non-antigen) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">4 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">170 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">196 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">GVHAGTDLEGNFYGPFVDRQTAQAAGT \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">27 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.2846(Probable non-antigen) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">5 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">225 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">228 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">TTLN \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">4 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0(Probable non-antigen) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">6 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">236 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">247 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">KYNYEPLTQDHV \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">12 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.9135(Probable antigen) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">7 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">273 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">278 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">QNGMNG \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">6 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.1867(Probable antigen) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">8 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">290 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">298 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">EFTPFDVVR \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">9 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.6049(Probable antigen) \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr></tbody></table> """ ] "imagenFichero" => array:1 [ 0 => "xTab3498258.png" ] ] ] ] "descripcion" => array:1 [ "en" => "<p id="sp0030" class="elsevierStyleSimplePara elsevierViewall">List of lineal B-cell epitopes for NSP5 protein with their sequence, length, site, antigenicity and probable allergenicity.</p>" ] ] 6 => array:8 [ "identificador" => "t0020" "etiqueta" => "Table 4" "tipo" => "MULTIMEDIATABLA" "mostrarFloat" => true "mostrarDisplay" => false "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0035" "detalle" => "Table " "rol" => "short" ] ] "tabla" => array:1 [ "tablatextoimagen" => array:1 [ 0 => array:2 [ "tabla" => array:1 [ 0 => """ <table border="0" frame="\n \t\t\t\t\tvoid\n \t\t\t\t" class=""><thead title="thead"><tr title="table-row"><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Peptide \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Start position \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Score \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Allergenicity \t\t\t\t\t\t\n \t\t\t\t\t\t</th></tr></thead><tbody title="tbody"><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">MLNPNYEDL \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">49 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.197 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">IRKSNHNFL \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">59 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.128 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">VLAWLYAAV \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">209 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.122 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">AMRPNFTIK \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">129 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.117 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">TPFDVVRQC \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">292 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.048 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">GSPSGVYQC \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">120 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.025 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">TLNDFNLVA \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">226 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.948 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">FLNRFTTTL \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">219 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.889 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">ITVNVLAWL \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">200 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.855 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">TVNVLAWLY \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">201 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.780 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">Non-allergen \t\t\t\t\t\t\n \t\t\t\t</td></tr></tbody></table> """ ] "imagenFichero" => array:1 [ 0 => "xTab3498257.png" ] ] ] ] "descripcion" => array:1 [ "en" => "<p id="sp0035" class="elsevierStyleSimplePara elsevierViewall">T-cell epitope prediction of SARS- CoV-2 protease and its allergenicity.</p>" ] ] 7 => array:8 [ "identificador" => "t0025" "etiqueta" => "Table 5" "tipo" => "MULTIMEDIATABLA" "mostrarFloat" => true "mostrarDisplay" => false "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0040" "detalle" => "Table " "rol" => "short" ] ] "tabla" => array:1 [ "tablatextoimagen" => array:1 [ 0 => array:2 [ "tabla" => array:1 [ 0 => """ <table border="0" frame="\n \t\t\t\t\tvoid\n \t\t\t\t" class=""><thead title="thead"><tr title="table-row"><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Peptide \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Length \t\t\t\t\t\t\n \t\t\t\t\t\t</th><th class="td" title="\n \t\t\t\t\ttable-head\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t" scope="col" style="border-bottom: 2px solid black">Score \t\t\t\t\t\t\n \t\t\t\t\t\t</th></tr></thead><tbody title="tbody"><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">FYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYE \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">60 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">1.51334 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">SGVTFQ \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">6 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.16646 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">PLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">60 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">0.1167 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIR \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">60 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.01126 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">SPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGN \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">60 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.11804 \t\t\t\t\t\t\n \t\t\t\t</td></tr><tr title="table-row"><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">KSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNG \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">60 \t\t\t\t\t\t\n \t\t\t\t</td><td class="td" title="\n \t\t\t\t\ttable-entry\n \t\t\t\t " align="" valign="\n \t\t\t\t\ttop\n \t\t\t\t">−<span class="elsevierStyleHsp" style=""></span>0.9389 \t\t\t\t\t\t\n \t\t\t\t</td></tr></tbody></table> """ ] "imagenFichero" => array:1 [ 0 => "xTab3498260.png" ] ] ] ] "descripcion" => array:1 [ "en" => "<p id="sp0040" class="elsevierStyleSimplePara elsevierViewall">Showing class I immunogenicity of NSP5 protein of SARS-CoV-2.</p>" ] ] 8 => array:7 [ "identificador" => "ec0015" "tipo" => "MULTIMEDIAECOMPONENTE" "mostrarFloat" => false "mostrarDisplay" => true "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0055" "detalle" => "Image " "rol" => "short" ] ] "Ecomponente" => array:2 [ "fichero" => "mmc3.docx" "ficheroTamanyo" => 15151 ] "descripcion" => array:1 [ "en" => "<p id="sp0065" class="elsevierStyleSimplePara elsevierViewall">Supplementary material 1</p>" ] ] 9 => array:7 [ "identificador" => "ec0020" "tipo" => "MULTIMEDIAECOMPONENTE" "mostrarFloat" => false "mostrarDisplay" => true "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0060" "detalle" => "Image " "rol" => "short" ] ] "Ecomponente" => array:2 [ "fichero" => "mmc4.docx" "ficheroTamanyo" => 13370 ] "descripcion" => array:1 [ "en" => "<p id="sp0070" class="elsevierStyleSimplePara elsevierViewall">Supplementary material 2</p>" ] ] 10 => array:7 [ "identificador" => "ec0025" "tipo" => "MULTIMEDIAECOMPONENTE" "mostrarFloat" => false "mostrarDisplay" => true "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0065" "detalle" => "Image " "rol" => "short" ] ] "Ecomponente" => array:2 [ "fichero" => "mmc5.docx" "ficheroTamanyo" => 12070 ] "descripcion" => array:1 [ "en" => "<p id="sp0075" class="elsevierStyleSimplePara elsevierViewall">Supplementary material 3</p>" ] ] 11 => array:7 [ "identificador" => "ec0005" "tipo" => "MULTIMEDIAFIGURA" "mostrarFloat" => false "mostrarDisplay" => true "figura" => array:1 [ 0 => array:4 [ "imagen" => "mmc1.jpeg" "Alto" => 786 "Ancho" => 1028 "Tamanyo" => 113846 ] ] "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0045" "detalle" => "Image " "rol" => "short" ] ] "descripcion" => array:1 [ "en" => "<p id="sp0055" class="elsevierStyleSimplePara elsevierViewall">Supplementary Fig. 1. Frequency of different point mutations found in NSP5 protein in India.</p>" ] ] 12 => array:7 [ "identificador" => "ec0010" "tipo" => "MULTIMEDIAFIGURA" "mostrarFloat" => false "mostrarDisplay" => true "figura" => array:1 [ 0 => array:4 [ "imagen" => "mmc2.jpeg" "Alto" => 1989 "Ancho" => 1030 "Tamanyo" => 381043 ] ] "detalles" => array:1 [ 0 => array:3 [ "identificador" => "al0050" "detalle" => "Image " "rol" => "short" ] ] "descripcion" => array:1 [ "en" => "<p id="sp0060" class="elsevierStyleSimplePara elsevierViewall">Supplementary Fig. 2. Protein modeling of wild type and mutant NSP5 protein.</p>" ] ] ] "bibliografia" => array:2 [ "titulo" => "References" "seccion" => array:1 [ 0 => array:2 [ "identificador" => "bs0005" "bibliografiaReferencia" => array:42 [ 0 => array:3 [ "identificador" => "bb0005" "etiqueta" => "1." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Genomic characterisation and epidemiology of 2019 novel coronavirus: implications for virus origins and receptor binding" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "R. Lu" 1 => "X. Zhao" 2 => "J. Li" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:6 [ "tituloSerie" => "The Lancet" "fecha" => "2020" "volumen" => "395" "numero" => "10224" "paginaInicial" => "565" "paginaFinal" => "574" ] ] ] ] ] ] 1 => array:3 [ "identificador" => "bb0010" "etiqueta" => "2." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "A novel coronavirus from patients with pneumonia in China, 2019" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "N. Zhu" 1 => "D. Zhang" 2 => "W. Wang" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1056/NEJMoa2001017" "Revista" => array:6 [ "tituloSerie" => "New Engl J Med" "fecha" => "2020" "volumen" => "382" "paginaInicial" => "727" "paginaFinal" => "733" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/31978945" "web" => "Medline" ] ] ] ] ] ] ] ] 2 => array:3 [ "identificador" => "bb0015" "etiqueta" => "3." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Coronavirus disease (Covid-19) pandemic" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:1 [ 0 => "WHO" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "WWW" => array:2 [ "link" => "https://www.who.int/emergencies/diseases/novel-coronavirus-2019" "fecha" => "2021" ] ] ] ] ] ] 3 => array:3 [ "identificador" => "bb0020" "etiqueta" => "[4]" "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "SARS-CoV-2 escape from a highly neutralizing COVID-19 convalescent plasma" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:1 [ 0 => "E. Andreano" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1073/pnas.2103154118" "Revista" => array:4 [ "tituloSerie" => "Proc Natl Acad Sci U S A" "fecha" => "2021" "volumen" => "118" "numero" => "36" ] ] ] ] ] ] 4 => array:3 [ "identificador" => "bb0025" "etiqueta" => "5." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Comprehensive mapping of mutations in the SARS-CoV-2 receptor-binding domain that affect recognition by polyclonal human plasma antibodies" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:1 [ 0 => "A.J. Greaney" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1016/j.chom.2021.02.003" "Revista" => array:7 [ "tituloSerie" => "Cell Host Microbe" "fecha" => "2021" "volumen" => "29" "numero" => "3" "paginaInicial" => "463" "paginaFinal" => "476" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/33592168" "web" => "Medline" ] ] ] ] ] ] ] ] 5 => array:3 [ "identificador" => "bb0030" "etiqueta" => "6." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Genomic characterization of the 2019 novel human-pathogenic coronavirus isolated from a patient with atypical pneumonia after visiting Wuhan" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "J.F. Chan" 1 => "K.H. Kok" 2 => "Z. Zhu" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1080/22221751.2020.1719902" "Revista" => array:6 [ "tituloSerie" => "Emerg Microbes Infect" "fecha" => "2020" "volumen" => "9" "paginaInicial" => "221" "paginaFinal" => "236" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/31987001" "web" => "Medline" ] ] ] ] ] ] ] ] 6 => array:3 [ "identificador" => "bb0035" "etiqueta" => "7." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "A SARS-CoV-2-human protein-protein interaction map reveals drug targets and potential drug-repurposing" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "D. Gordon" 1 => "G. Jang" 2 => "M. Bouhaddou" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1101/2020.03.22.002386" "Revista" => array:2 [ "tituloSerie" => "bioRxiv" "fecha" => "2020" ] ] ] ] ] ] 7 => array:3 [ "identificador" => "bb0040" "etiqueta" => "8." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "A new coronavirus associated with human respiratory disease in China" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "F. Wu" 1 => "S. Zhao" 2 => "B. Yu" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1038/s41586-020-2008-3" "Revista" => array:7 [ "tituloSerie" => "Nature." "fecha" => "2020" "volumen" => "579" "numero" => "7798" "paginaInicial" => "265" "paginaFinal" => "269" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/32015508" "web" => "Medline" ] ] ] ] ] ] ] ] 8 => array:3 [ "identificador" => "bb0045" "etiqueta" => "9." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "SARS–CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "T. Muramatsu" 1 => "C. Takemoto" 2 => "Y. Kim" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1073/pnas.1601327113" "Revista" => array:6 [ "tituloSerie" => "Proc Natl Acad Sci U S A" "fecha" => "2016" "volumen" => "113" "paginaInicial" => "12997" "paginaFinal" => "13002" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/27799534" "web" => "Medline" ] ] ] ] ] ] ] ] 9 => array:3 [ "identificador" => "bb0050" "etiqueta" => "10." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "The proteins of severe acute respiratory syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the cause of COVID-19" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:1 [ 0 => "F.K. Yoshimoto" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1007/s10930-020-09901-4" "Revista" => array:6 [ "tituloSerie" => "Protein J" "fecha" => "2020" "volumen" => "39" "paginaInicial" => "198" "paginaFinal" => "216" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/32447571" "web" => "Medline" ] ] ] ] ] ] ] ] 10 => array:3 [ "identificador" => "bb0055" "etiqueta" => "11." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Coronaviruses: an overview of their replication and pathogenesis" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:2 [ 0 => "A.R. Fehr" 1 => "S. Perlman" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1007/978-1-4939-2438-7_1" "Revista" => array:6 [ "tituloSerie" => "Methods Mol Biol" "fecha" => "2015" "volumen" => "1282" "paginaInicial" => "1" "paginaFinal" => "23" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/25720466" "web" => "Medline" ] ] ] ] ] ] ] ] 11 => array:3 [ "identificador" => "bb0060" "etiqueta" => "12." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Virus-encoded proteinases and proteolytic processing in the Nidovirales" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:3 [ 0 => "J. Ziebuhr" 1 => "A.E. Gorbalenya" 2 => "E.J. Snijder" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1099/0022-1317-81-4-853" "Revista" => array:6 [ "tituloSerie" => "J Gen Virol" "fecha" => "2000" "volumen" => "81" "paginaInicial" => "853" "paginaFinal" => "879" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/10725411" "web" => "Medline" ] ] ] ] ] ] ] ] 12 => array:3 [ "identificador" => "bb0065" "etiqueta" => "13." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Chimeric exchange of coronavirus NSP5 proteases (3CLpro) identifies common and divergent regulatory determinants of protease activity" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:5 [ 0 => "C.C. Stobart" 1 => "N.R. Sexton" 2 => "H. Munjal" 3 => "X. Lu" 4 => "K.L. Molland" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1128/JVI.02050-13" "Revista" => array:6 [ "tituloSerie" => "J Virol" "fecha" => "2013" "volumen" => "87" "paginaInicial" => "12611" "paginaFinal" => "12618" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/24027335" "web" => "Medline" ] ] ] ] ] ] ] ] 13 => array:3 [ "identificador" => "bb0070" "etiqueta" => "14." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Intracellular and in vitro-translated 27-kDa proteins contain the 3C-like proteinase activity of the coronavirus MHV-A59" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:3 [ 0 => "X. Lu" 1 => "Y. Lu" 2 => "M.R. Denison" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1006/viro.1996.0434" "Revista" => array:6 [ "tituloSerie" => "Virology." "fecha" => "1996" "volumen" => "222" "paginaInicial" => "375" "paginaFinal" => "382" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/8806521" "web" => "Medline" ] ] ] ] ] ] ] ] 14 => array:3 [ "identificador" => "bb0075" "etiqueta" => "15." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Crystal structure of SARS-CoV-2 main protease provides a basis for design of improved a-ketoamide inhibitors" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:6 [ 0 => "L. Zhang" 1 => "D. Lin" 2 => "X. Sun" 3 => "U. Curth" 4 => "C. Drosten" 5 => "L. Sauerhering" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1126/science.abb3405" "Revista" => array:6 [ "tituloSerie" => "Science." "fecha" => "2020" "volumen" => "368" "paginaInicial" => "409" "paginaFinal" => "412" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/32198291" "web" => "Medline" ] ] ] ] ] ] ] ] 15 => array:3 [ "identificador" => "bb0080" "etiqueta" => "16." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Structure of M pro from SARS-CoV-2 and discovery of its inhibitors" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:6 [ 0 => "Z. Jin" 1 => "X. Du" 2 => "Y. Xu" 3 => "Y. Deng" 4 => "M. Liu" 5 => "Y. Zhao" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1038/s41586-020-2223-y" "Revista" => array:6 [ "tituloSerie" => "Nature." "fecha" => "2020" "volumen" => "582" "paginaInicial" => "289" "paginaFinal" => "293" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/32272481" "web" => "Medline" ] ] ] ] ] ] ] ] 16 => array:3 [ "identificador" => "bb0085" "etiqueta" => "17." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Immunoinformatics identification of B- and T-cell epitopes in the RNA-dependent RNA polymerase of SARS-CoV-2" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:3 [ 0 => "N. Yashvardhini" 1 => "A. Kumar" 2 => "D.K. Jha" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1155/2021/6627141" "Revista" => array:2 [ "tituloSerie" => "Can J Infect Dis Med Microbiol" "fecha" => "2021" ] ] ] ] ] ] 17 => array:3 [ "identificador" => "bb0090" "etiqueta" => "18." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "The EMBL-EBI search and sequence analysis tools APIs in 2019" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "F. Madeira" 1 => "Y. Park" 2 => "J. Lee" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1093/nar/gkz268" "Revista" => array:7 [ "tituloSerie" => "Nucl Acids Res" "fecha" => "2019" "volumen" => "47" "numero" => "W1" "paginaInicial" => "W636" "paginaFinal" => "W641" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/30976793" "web" => "Medline" ] ] ] ] ] ] ] ] 18 => array:3 [ "identificador" => "bb0095" "etiqueta" => "19." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "PROVEAN web server: a tool to predict the functional effect of amino acid substitutions and indels" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:1 [ 0 => "Y. Choi" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:6 [ "tituloSerie" => "Bioinfo." "fecha" => "2015" "volumen" => "31" "numero" => "16" "paginaInicial" => "2745" "paginaFinal" => "2747" ] ] ] ] ] ] 19 => array:3 [ "identificador" => "bb0100" "etiqueta" => "20." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Protein identification and analysis tools on the ExPASy server" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "E. Gasteiger" 1 => "C. Hoogland" 2 => "A. Gattiker" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:4 [ "tituloSerie" => "Prot Proto Hand" "fecha" => "2005" "paginaInicial" => "571" "paginaFinal" => "607" ] ] ] ] ] ] 20 => array:3 [ "identificador" => "bb0105" "etiqueta" => "21." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "CFSSP: Chou and Fasman secondary structure prediction server" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:1 [ 0 => "T. Ashok Kumar" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.5281/zenodo.50733" "Revista" => array:5 [ "tituloSerie" => "Wide Spec" "fecha" => "2013" "volumen" => "1" "paginaInicial" => "15" "paginaFinal" => "19" ] ] ] ] ] ] 21 => array:3 [ "identificador" => "bb0110" "etiqueta" => "22." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "The Phyre2 web portal for protein modeling, prediction and analysis" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:4 [ 0 => "L. Kelley" 1 => "S. Mezulis" 2 => "C. Yates" 3 => "M. Wass" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:6 [ "tituloSerie" => "Nat Proto" "fecha" => "2015" "volumen" => "10" "numero" => "6" "paginaInicial" => "845" "paginaFinal" => "858" ] ] ] ] ] ] 22 => array:3 [ "identificador" => "bb0115" "etiqueta" => "23." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "DynaMut: predicting the impact of mutations on protein conformation, flexibility and stability" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:3 [ 0 => "C.H.M. Rodrigues" 1 => "D.E.V. Pires" 2 => "D.B. Ascher" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:6 [ "tituloSerie" => "Nucl Acid Res" "fecha" => "2018" "volumen" => "46" "numero" => "W1" "paginaInicial" => "W350" "paginaFinal" => "W355" ] ] ] ] ] ] 23 => array:3 [ "identificador" => "bb0120" "etiqueta" => "24." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Immune epitope database analysis resource" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "Y. Kim" 1 => "J. Ponomarenko" 2 => "Z. Zhu" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:6 [ "tituloSerie" => "Nucl acid Res" "fecha" => "2012" "volumen" => "40" "numero" => "W1" "paginaInicial" => "W525" "paginaFinal" => "W530" ] ] ] ] ] ] 24 => array:3 [ "identificador" => "bb0125" "etiqueta" => "25." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "VaxiJen: a server for prediction of protective antigens, tumour antigens and subunit vaccines" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:2 [ 0 => "I.A. Doytchinova" 1 => "D.R. Flower" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1186/1471-2105-8-4" "Revista" => array:5 [ "tituloSerie" => "BMC Bioinfo." "fecha" => "2017" "volumen" => "8" "numero" => "1" "paginaInicial" => "4" ] ] ] ] ] ] 25 => array:3 [ "identificador" => "bb0130" "etiqueta" => "26." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "AllerTOP-a server for in silico prediction of allergens" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:3 [ 0 => "I. Dimitrov" 1 => "D.R. Flower" 2 => "I. Doytchinova" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1186/1471-2105-14-S6-S4" "Revista" => array:5 [ "tituloSerie" => "BMC Bioinfo" "fecha" => "2013" "volumen" => "14" "numero" => "Suppl 6" "paginaInicial" => "S4" ] ] ] ] ] ] 26 => array:3 [ "identificador" => "bb0135" "etiqueta" => "27." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "The 2019-new coronavirus epidemic: evidence for virus evolution" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:6 [ 0 => "D. Benvenuto" 1 => "M. Giovanetti" 2 => "A. Ciccozzi" 3 => "S. Spoto" 4 => "S. Angeletti" 5 => "M. Ciccozzi" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1002/jmv.25688" "Revista" => array:7 [ "tituloSerie" => "J Med Virol" "fecha" => "2020" "volumen" => "92" "numero" => "4" "paginaInicial" => "455" "paginaFinal" => "459" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/31994738" "web" => "Medline" ] ] ] ] ] ] ] ] 27 => array:3 [ "identificador" => "bb0140" "etiqueta" => "28." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Temperature significant change COVID-19 transmission in 429 cities" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:1 [ 0 => "M.A. Wang" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:2 [ "tituloSerie" => "medRxiv" "fecha" => "2020" ] ] ] ] ] ] 28 => array:3 [ "identificador" => "bb0145" "etiqueta" => "29." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Targeting novel structural and functional features of coronavirus protease nsp5 (3CLpro, Mpro) in the age of COVID-19" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:5 [ 0 => "M.K. Roe" 1 => "N.A. Junod" 2 => "A.R. Young" 3 => "D.C. Beachboard" 4 => "C.C. Stobart" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1099/jgv.0.001558" "Revista" => array:4 [ "tituloSerie" => "J Gen Virol" "fecha" => "2021" "volumen" => "102" "numero" => "3" ] ] ] ] ] ] 29 => array:3 [ "identificador" => "bb0150" "etiqueta" => "30." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Analysis of murine hepatitis virus strain A59 temperature-sensitive mutant TS-LA6 suggests that nsp10 plays a critical role in polyprotein processing" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:5 [ 0 => "E.F. Donaldson" 1 => "R.L. Graham" 2 => "A.C. Sims" 3 => "M.R. Denison" 4 => "R.S. Baric" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1128/JVI.00049-07" "Revista" => array:6 [ "tituloSerie" => "J Virol" "fecha" => "2007" "volumen" => "81" "paginaInicial" => "7086" "paginaFinal" => "7098" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/17428870" "web" => "Medline" ] ] ] ] ] ] ] ] 30 => array:3 [ "identificador" => "bb0155" "etiqueta" => "31." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Temperature-sensitive mutants and revertants in the coronavirus nonstructural protein 5 protease (3CLpro) defne residues involved in long-distance communication and regulation of protease activity" "autores" => array:1 [ 0 => array:2 [ "etal" => false "autores" => array:4 [ 0 => "C.C. Stobart" 1 => "A.S. Lee" 2 => "X. Lu" 3 => "M.R. Denison" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1128/JVI.06754-11" "Revista" => array:6 [ "tituloSerie" => "J Virol" "fecha" => "2012" "volumen" => "86" "paginaInicial" => "4801" "paginaFinal" => "4810" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/22345451" "web" => "Medline" ] ] ] ] ] ] ] ] 31 => array:3 [ "identificador" => "bb0160" "etiqueta" => "32." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "A new cistron in the murine hepatitis virus replicase gene" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:5 [ 0 => "H.L. Stokes" 1 => "S. Baliji" 2 => "C.G. Hui" 3 => "S.G. Sawicki" 4 => "S.C. Baker" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1128/JVI.00901-10" "Revista" => array:6 [ "tituloSerie" => "J Virol" "fecha" => "2010" "volumen" => "84" "paginaInicial" => "10148" "paginaFinal" => "10158" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/20668085" "web" => "Medline" ] ] ] ] ] ] ] ] 32 => array:3 [ "identificador" => "bb0165" "etiqueta" => "33." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "A new coronavirus associated with human respiratory disease in China" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "F. Wu" 1 => "S. Zhao" 2 => "B. Yu" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1038/s41586-020-2008-3" "Revista" => array:7 [ "tituloSerie" => "Nature." "fecha" => "2020" "volumen" => "579" "numero" => "7798" "paginaInicial" => "265" "paginaFinal" => "269" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/32015508" "web" => "Medline" ] ] ] ] ] ] ] ] 33 => array:3 [ "identificador" => "bb0170" "etiqueta" => "34." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Characterization of the receptor-binding domain (RBD) of 2019 novel coronavirus: implication for development of RBD protein as a viral attachment inhibitor and vaccine" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:4 [ 0 => "W. Tai" 1 => "L. He" 2 => "X. Zhang" 3 => "J. Pu" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:4 [ "tituloSerie" => "Cell Mol Immunol" "fecha" => "2020" "paginaInicial" => "1" "paginaFinal" => "8" ] ] ] ] ] ] 34 => array:3 [ "identificador" => "bb0175" "etiqueta" => "35." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Epidemiological and clinical characteristics of 99 cases of 2019 novel coronavirus pneumonia in Wuhan, China: a descriptive study" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:1 [ 0 => "N. Chen" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1016/S0140-6736(20)30211-7" "Revista" => array:7 [ "tituloSerie" => "Lancet" "fecha" => "2020" "volumen" => "395" "numero" => "10223" "paginaInicial" => "507" "paginaFinal" => "513" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/32007143" "web" => "Medline" ] ] ] ] ] ] ] ] 35 => array:3 [ "identificador" => "bb0180" "etiqueta" => "[36]" "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Early transmission dynamics in Wuhan, China, of novel coronavirusinfected pneumonia" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:1 [ 0 => "Q. Li" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1056/NEJMoa2001316" "Revista" => array:7 [ "tituloSerie" => "New Engl J Med" "fecha" => "2020" "volumen" => "382" "numero" => "13" "paginaInicial" => "1199" "paginaFinal" => "1207" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/31995857" "web" => "Medline" ] ] ] ] ] ] ] ] 36 => array:3 [ "identificador" => "bb0185" "etiqueta" => "37." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Advanced in silico tools for designing of antigenic epitope as potential vaccine candidates against coronavirus" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "M. Dangi" 1 => "R. Kumari" 2 => "R. Singh" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:4 [ "tituloSerie" => "Bioinfor Seq Struct Phylogeny" "fecha" => "2018" "paginaInicial" => "329" "paginaFinal" => "357" ] ] ] ] ] ] 37 => array:3 [ "identificador" => "bb0190" "etiqueta" => "38." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "A randomized phase II trial of multiepitope vaccination with melanoma peptides for cytotoxic T cells and helper T cells for patients with metastatic melanoma (E1602)" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "C.L. Jr Slingluff" 1 => "S. Lee" 2 => "F. Zhao" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1158/1078-0432.CCR-13-0002" "Revista" => array:7 [ "tituloSerie" => "Clin Cancer Res" "fecha" => "2013" "volumen" => "19" "numero" => "15" "paginaInicial" => "4228" "paginaFinal" => "4238" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/23653149" "web" => "Medline" ] ] ] ] ] ] ] ] 38 => array:3 [ "identificador" => "bb0195" "etiqueta" => "39." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "A phase I clinical trial of a multi-epitope polypeptide TAB9 combined with Montanide ISA 720 adjuvant in non-HIV-1 infected human volunteers" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "H. Toledo" 1 => "A. Baly" 2 => "O. Castro" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1016/s0264-410x(01)00111-6" "Revista" => array:7 [ "tituloSerie" => "Vaccine" "fecha" => "2001" "volumen" => "19" "numero" => "30" "paginaInicial" => "4328" "paginaFinal" => "4336" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/11457560" "web" => "Medline" ] ] ] ] ] ] ] ] 39 => array:3 [ "identificador" => "bb0200" "etiqueta" => "40." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Phylogenetic analysis and structural perspectives of RNA-dependent RNA-polymerase inhibition from SARs-CoV-2 with natural products" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "A. Khan" 1 => "D.M. Khan" 2 => "S. Saleem" ] ] ] ] ] "host" => array:1 [ 0 => array:1 [ "Revista" => array:6 [ "tituloSerie" => "Interdis Sci Comput Life Sci" "fecha" => "2020" "volumen" => "12" "numero" => "2" "paginaInicial" => "335" "paginaFinal" => "348" ] ] ] ] ] ] 40 => array:3 [ "identificador" => "bb0205" "etiqueta" => "41." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "Mutation analysis of the cross-reactive epitopes of Japanese encephalitis virus envelope glycoprotein" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "S.S. Chiou" 1 => "Y.C. Fan" 2 => "W.D. Crill" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1099/vir.0.040238-0" "Revista" => array:6 [ "tituloSerie" => "J Gen Virol" "fecha" => "2012" "volumen" => "93" "paginaInicial" => "1185" "paginaFinal" => "1192" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/22337639" "web" => "Medline" ] ] ] ] ] ] ] ] 41 => array:3 [ "identificador" => "bb0210" "etiqueta" => "42." "referencia" => array:1 [ 0 => array:2 [ "contribucion" => array:1 [ 0 => array:2 [ "titulo" => "The spike protein of SARSCoV — a target for vaccine and therapeutic development" "autores" => array:1 [ 0 => array:2 [ "etal" => true "autores" => array:3 [ 0 => "L. Du" 1 => "Y. He" 2 => "Y. Zhou" ] ] ] ] ] "host" => array:1 [ 0 => array:2 [ "doi" => "10.1038/nrmicro2090" "Revista" => array:6 [ "tituloSerie" => "Nat Rev Microbiol" "fecha" => "2009" "volumen" => "7" "paginaInicial" => "226" "paginaFinal" => "236" "link" => array:1 [ 0 => array:2 [ "url" => "https://www.ncbi.nlm.nih.gov/pubmed/19198616" "web" => "Medline" ] ] ] ] ] ] ] ] ] ] ] ] ] "idiomaDefecto" => "en" "url" => "/15769887/00000023000000S1/v4_202403290955/S1576988721000777/v4_202403290955/en/main.assets" "Apartado" => array:4 [ "identificador" => "17855" "tipo" => "SECCION" "en" => array:2 [ "titulo" => "Originales" "idiomaDefecto" => true ] "idiomaDefecto" => "en" ] "PDF" => "https://static.elsevier.es/multimedia/15769887/00000023000000S1/v4_202403290955/S1576988721000777/v4_202403290955/en/main.pdf?idApp=UINPBA00004N&text.app=https://www.elsevier.es/" "EPUB" => "https://multimedia.elsevier.es/PublicationsMultimediaV1/item/epub/S1576988721000777?idApp=UINPBA00004N" ]
Year/Month | Html | Total | |
---|---|---|---|
2024 November | 11 | 4 | 15 |
2024 October | 76 | 5 | 81 |
2024 September | 92 | 5 | 97 |
2024 August | 79 | 7 | 86 |
2024 July | 96 | 6 | 102 |
2024 June | 92 | 8 | 100 |
2024 May | 78 | 9 | 87 |
2024 April | 76 | 6 | 82 |
2024 March | 46 | 9 | 55 |
2024 February | 43 | 4 | 47 |
2024 January | 31 | 0 | 31 |
2023 December | 55 | 0 | 55 |
2023 November | 63 | 0 | 63 |
2023 October | 63 | 0 | 63 |
2023 September | 49 | 0 | 49 |
2023 August | 40 | 0 | 40 |
2023 July | 71 | 0 | 71 |
2023 June | 69 | 4 | 73 |
2023 May | 56 | 2 | 58 |
2023 April | 27 | 2 | 29 |
2023 March | 5 | 5 | 10 |
2023 February | 4 | 6 | 10 |
2023 January | 5 | 10 | 15 |
2022 December | 5 | 7 | 12 |
2022 November | 4 | 8 | 12 |
2022 October | 10 | 16 | 26 |
2022 September | 5 | 8 | 13 |
2022 August | 4 | 2 | 6 |
2022 July | 2 | 10 | 12 |
2022 June | 4 | 10 | 14 |
2022 May | 0 | 15 | 15 |
2022 April | 0 | 10 | 10 |
2022 March | 0 | 7 | 7 |
2022 February | 0 | 7 | 7 |
2022 January | 0 | 2 | 2 |